PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B02197.1.p
Common NameEUGRSUZ_B02197, LOC104432590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 407aa    MW: 45629 Da    PI: 8.2831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B02197.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.36.2e-171461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g W++eEde+lv+ + ++G g+W+++++  g+ R++k+c++rw +yl
  Eucgr.B02197.1.p 14 KGLWSPEEDEKLVRHIVKYGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                      678*******************************************97 PP

2Myb_DNA-binding44.24.6e-1467109145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       rg ++++E++l++++++ lG++ W+ Ia+ ++ gRt++++k+ w+
  Eucgr.B02197.1.p  67 RGTFSQQEEDLIIELHAVLGNR-WSQIASQLP-GRTDNEIKNLWN 109
                       899*******************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-27664IPR009057Homeodomain-like
PROSITE profilePS5129424.792965IPR017930Myb domain
SuperFamilySSF466891.83E-2912108IPR009057Homeodomain-like
SMARTSM007173.2E-131363IPR001005SANT/Myb domain
PfamPF002493.4E-151461IPR001005SANT/Myb domain
CDDcd001676.67E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.0E-2465117IPR009057Homeodomain-like
SMARTSM007178.4E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.15566116IPR017930Myb domain
PfamPF002496.2E-1367109IPR001005SANT/Myb domain
CDDcd001675.08E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLVRHIV KYGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQQEEDLIIE LHAVLGNRWS QIASQLPGRT DNEIKNLWNS SIKKKLIQKG  120
IDPNTHKPLS EVKNGREGEK TPKSGNFGNR TSGGFSSMYN LEFDAPKSEE RKPISQDAEP  180
YSLTGSLSLK IHHPDTSKSI NPAPARKLFS EKSADLSEKI PFEPTRIFPF QQLSYGSSAD  240
YSFDPYLNHN FMLSDSKSAL HSTSAPAILP QSHSFSSLTA QPHESLKPHF GLFSNGKIRS  300
SESQSSLFPW DLHAEKEEDE THQPNFSGNE SEDLKWSDYL NMPFLIANPG QGQEKQAPPN  360
GVVSDARFIS ELSCVEGNNQ QQELPSQGSD IYCKGIRRLA ATFGNY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29121165108B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B02197.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010043353.10.0PREDICTED: transcription repressor MYB4-like
TrEMBLA0A059D4G40.0A0A059D4G4_EUCGR; Uncharacterized protein
STRINGPOPTR_0014s10680.11e-106(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-95myb domain protein 61